• English
  • Sign In
  • Contact Us
×
Catalog Products » Recombinant Proteins » Growth Factors » Transforming Growth Factor β-2, Mouse

TGF-β 2, Mouse

Synonyms TGFB2; BSC-1 cell growth inhibitor; Cetermin; Glioblastoma-derived T-cell suppressor factor; G-TSF; MGC116892; Polyergin; TGF-beta2; TGF-beta-2; transforming growth factor beta-2
Description Transforming growth factor beta 2 (TGF-β2) is a member of TGF-beta superfamily that shares a characteristic cysteine knot structure. Mice with TGF-β2 gene deletion show defects in development of cardiac, lung, craniofacial, limb, spinal column, eye, inner ear and urogenital systems. All TGF-β isoforms signal via the same heteromeric receptor complex, consisting of a ligand binding TGF-β receptor type II (TβR-II), and a TGF-β receptor type I (TβR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF-β expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, hematopoietic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.
Recombinant Mouse TGF-β2 produced by a mammalian expression system is a polypeptide chain containing 112 amino acids. A fully biologically active molecule; rm TGF-β2 a molecular mass of 12.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Source Human Cells
Biological Activity ED50 <0.2 ng/ml, measured in a cell proliferation assay using mouse HT-2 cells.
Sequence
Ala³⁰³-Ser⁴¹⁴ (Accession #: P27090);
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH
EPKGYNANFCAGACPYLWSSDTQHTKVLSLY NT
INPEASASPCCVSQDLEPLTILYYIGNTPKIEQL
SNMIVKSCKCS

Measured Molecular Weight 12.7 kDa; observed by reducing SDS-PAGE.
Purity > 95% as analyzed by SDS-PAGE.
Formulation Lyophilized from a 0.2 μm filtered solution in 4 mM HCl.
Reconstitution Reconstituted in ddH₂O or PBS at 100 μg/ml.
Endotoxin Level < 1 EU/μg; determined by LAL method.
Storage Lyophilized recombinant TGF-β2, Mouse remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution; Mouse TGF-β2 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z03432
Size
Price
10 µg $195.00
50 µg $550.00
1 mg $3000.00