• English
  • Sign In
  • Contact Us
×
Catalog Products » Recombinant Proteins » Other Catalog Proteins » R-Spondin-1/ RSPO1, His, Human

RSPO1, His, Human

Synonyms RSPO1, R-spondin1, RP11-566C13.1, CRISTIN3, FLJ40906, RSPO Rspo1, R-spondin, Rspondin, RP23-325M14.2, Roof plate-specific spondin-1
Description RSPO1 is a secreted protein, containing 2 FU(furin-like) repeats and 1 TSP type-1 domain and belonging to the R-spondin family. RSPO1 is required for the early development of gonads, regardless of sex. It has been found in mice only eleven days after fertilization. To induce cell proliferation, it acts synergistically with WNT4. They help stabilize β catenin, which activates downstream targets. RSPO1 is necessary in female sex development. It augments the WNT/β catenin pathway to oppose male sex development. In critical gonadal stages, between six and nine weeks after fertilization, the ovaries upregulate it while the testes downregulate it. RSPO1 can potentially aid in the treatment of mucositis, which is characterized by inflammation of the oral cavity. This unfortunate condition often accompanies chemotherapy and radiation in cancer patients with head and neck tumors.
Recombinant Human RSPO1 produced by a mammalian expression system is a polypeptide chain containing 241 amino acids. A fully biologically active molecule; rh RSPO1 a molecular mass of 35 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Source Human Cells
Biological Activity Not available.
Sequence
Accession #: Q2MKA7;
RISAEGSQACAKGCELCSEVNGCLKCSPKLFILL
ERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCK
IEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEG
SSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLC
GFRRGSEERTRRVLHAPVGDHAACSDTKETRRCT
VRRVPCPEGQKRRKGGQGRRENANRNLARKESKE
AGAGSRRRKGQQQQQQQGTVGPLTSAGPAVDHHH
HHH

Measured Molecular Weight 35 kDa; observed by reducing SDS-PAGE.
Purity > 95% as analyzed by reducing SDS-PAGE.
Formulation Lyophilized from a 0.2 μm filtered solution in PBS.
Reconstitution Reconstituted in ddH₂O at 100 μg/ml.
Endotoxin Level < 1 EU/μg; determined by LAL method.
Storage Lyophilized recombinant RSPO1, His,Human remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution; Human RSPO1 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z03433
Size
Price
10 µg $159.00
50 µg $459.00
1 mg $2700.00