• English
  • Sign In
  • Contact Us
×
Catalog Products » Recombinant Proteins » Cytokines » Thrombopoietin/TPO, His,  Human

TPO, His,  Human

Synonyms Thrombopoietin;C-mpl ligand; Megakaryocyte colony-stimulating factor; Megakaryocyte growthand development factor; Myeloproliferative leukemia virus oncogene ligand;THPO
Description Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by the liver and kidney which regulates the production of platelets. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Recombinant Human TPO produced by a mammalian expression system is a polypeptide chain containing 346 amino acids. A fully biologically active molecule; rhTPO a molecular mass of 75-90 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Source Human Cells
Biological Activity Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells .The ED50 for this effect is typically 0.5-5 ng/mL.
Sequence
Ser²²-Gly³⁵³ (Accession #: P40225);
expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus.
HHHHHHSPAPPACDLRVLSKLLRDSHVLHSRLSQ
CPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQD
ILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQ
VRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLS
FQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSR
TSLVLTLNELPNRTSGLLETNFTASARTTGSGLL
KWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHEL
LNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPN
LQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLH
PLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEGVD
HHHHHH

Measured Molecular Weight 75-90 kDa; observed by reducing SDS-PAGE.
Purity > 95% as analyzed by reducing SDS-PAGE.
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Reconstitution Reconstituted in ddH₂O at 100 μg/ml.
Endotoxin Level < 1 EU/μg; determined by LAL method.
Storage Lyophilized recombinant TPO, His, Human remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution; Human TPO should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z03434
Size
Price
500 µg $1900.00
50 µg $550.00
10 µg $195.00
1 mg $2700.00