• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » Beta Amyloid Peptides » β-Amyloid (1-42), rat

β-Amyloid (1-42), rat

Synonyms Abeta 1-42, ratβ-Amyloid Peptide; βAmyloid Peptide; b-Amyloid Peptide; bAmyloid Peptide; beta-Amyloid Peptide; betaAmyloid Peptide
Description Abeta 1-42 induces a strong membrane destabilization in giant unilamellar vesicles composed of palmitoyloleoyl-phosphatidylcholine, sphingomyelin, and cholesterol, lowering the critical tension of vesicle rupture. Additionally, Abeta 1-42 triggers the induction of sequential leakage of low- and high-molecular-weight markers trapped inside the giant unilamellar vesicles, but preserving the vesicle shape. The Abeta 1-42 sequence confers particular molecular properties to the peptide that, in turn, influence supramolecular properties associated with membranes that may result in toxicity,including: 1) the ability of the peptide to strongly associate with the membrane; 2) a reduction of lateral membrane cohesive forces; and 3) a capacity to break the transbilayer gradient and puncture sealed vesicles.
Sequence
{ASP}{ALA}{GLU}{PHE}{GLY}{HIS}{ASP}{SER}{GLY}{PHE}{GLU}{VAL}
{ARG}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}
{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}
{GLY}{GLY}{VAL}{VAL}{ILE}{ALA}
Sequence Shortening DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Formula C199H307N53O59S1
Molecular Weight 4418.1

Purity > 95%
Gmp Flag 0
Anaspec Cat No Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
Storage Store at -20°C.
Note


Cat. No.
Product Name
Price
RP10017-1
β-Amyloid (1-42), human - 1 mg
$214.00
RP10017-0.5
β-Amyloid (1-42), human - 0.5 mg
$119.00
RP10016-0.5
β-Amyloid (1-40), rat - 0.5 mg
$157.00
RP10008-5
β-Amyloid (25-35) - 5 mg
$209.00
RP10008-1
β-Amyloid (25-35) - 1 mg
$52.00
RP10004-1
β-Amyloid (1-40) - 1 mg
$190.00
RP10004-0.5
β-Amyloid (1-40) - 0.5 mg
$114.00
RP10002-0.5
β-Amyloid (1-28) - 0.5 mg
$81.00
 
Folin M, et al. Apolipoprotein-E modulates the cytotoxic effect of beta-amyloid on rat brain endothelium in an isoform-dependent specific manner. Int J Mol Med. May 2006;17(5):821-826.

Chen L, et al. alpha7 Nicotinic acetylcholine receptor as a target to rescue deficit in hippocampal LTP induction in beta-amyloid infused rats. Neuropharmacology. Feb 2006;50(2):254-268.

Bastianetto S, et al. Neuroprotective effects of green and black teas and their catechin gallate esters against beta-amyloid-induced toxicity. Eur J Neurosci. Jan 2006;23(1):55-64.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10013
Size
Price
0.5 mg $176.00
1 mg $309.00